Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Canvas Painting
6 product(s) found for "Canvas Painting"
Highland Red -the highland Cow
Canvas Painting
Highland Red -the highland Cow
Highland Red- This is my large acrylic painting of a beautiful highland cow on canvas Size. 90 cm x 90 cm Box canvas Medium. Acrylic Paint
£1,300.00
Units in Stock: 1
£1,300.00
Details
Add To Cart
Highland Red- This is my large acrylic painting of a beautiful highland cow on canvas Size. 90 cm x 90 cm Box canvas Medium. Acrylic Paint
Winters Glow - Tiger painting
Canvas Painting
Winters Glow - Tiger painting
"Winters Glow" is my acrylic painting of a beautiful tiger on canvas Size. 90cm x 90cm Box Canvas Medium. Acrylic Paint
£1,995.00
Units in Stock: 1
£1,995.00
Details
Add To Cart
"Winters Glow" is my acrylic painting of a beautiful tiger on canvas Size. 90cm x 90cm Box Canvas Medium. Acrylic Paint
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i